PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_80033g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 346aa    MW: 39090.7 Da    PI: 7.9978
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_80033g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding431.1e-131462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+ eEd +l+++  + G g +W + ++++g++R++k+c++rw++yl
    MA_80033g0010 14 KGPWSREEDSKLKEYMDKCGAGgNWLALPQKVGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding40.94.7e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +  + G++ W+ Ia+ ++ gRt++++k++w++
    MA_80033g0010  69 GGFSEEEDHIICSLYIRIGSR-WSIIAAQLP-GRTDNDIKNHWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.957962IPR017930Myb domain
SuperFamilySSF466899.38E-2611109IPR009057Homeodomain-like
SMARTSM007173.7E-111364IPR001005SANT/Myb domain
PfamPF002497.0E-131462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-221569IPR009057Homeodomain-like
CDDcd001675.24E-81662No hitNo description
PROSITE profilePS5129422.23363117IPR017930Myb domain
SMARTSM007174.3E-1067115IPR001005SANT/Myb domain
PfamPF002491.6E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-2370117IPR009057Homeodomain-like
CDDcd001673.53E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGRAPCCDKS NVKKGPWSRE EDSKLKEYMD KCGAGGNWLA LPQKVGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDHIIC SLYIRIGSRW SIIAAQLPGR TDNDIKNHWN TRLKKKVLEK  120
HEDHQTCQPS ASRPERKDVQ SYATSEVNTS PNIFVQQQQP GGVDPYTNIG MNGLYSNFGT  180
GIISQLFEQN CGLRITESSS SSEPATFQLN HQQFQLDQGF SDHNSCVRKL LQRVEGTVVD  240
QHSNEGMSMI TSSPVDASNS INASQMPHST AHSQYKSRQI FHETSASPVL MYERQMENHI  300
KLNKPSAPLV HHDNSHAVSE SSWMNTFDAE KNLGAYRFST ELNDLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25141177108B-MYB
1h8a_C4e-251411727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1235190.0BT123519.1 Picea sitchensis clone WS04714_E01 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD5ABB60.0D5ABB6_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.13e-76myb domain protein 68